PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G156100.1.p
Common NameGLYMA_20G156100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 734aa    MW: 83980.6 Da    PI: 5.9432
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G156100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR157.44.9e-1875148177
                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwe 77 
                          +fYn+YA+ +GF+vrk+  ++sk +g++++r+f+Cs+eg +++++ +    +++r+etr gC a++ v+++ dgk++
  Glyma.20G156100.1.p  75 RFYNKYARLLGFNVRKDWINRSKVHGQVVSRKFTCSQEGWKDKRDAN---VKKHRKETRSGCLAHMIVNRQPDGKYQ 148
                          5******************************************9998...889999****************99996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-1575148IPR004330FAR1 DNA binding domain
PROSITE profilePS5096610.138413449IPR007527Zinc finger, SWIM-type
SMARTSM005750.0032424451IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    Send to blast
MDGDQNEFGS VHEGNVDIGP QTSNNLELNV EQNCCSPNVA RASDSQSCPP AANVLSCDTV  60
LGIGTEFESN DHAYRFYNKY ARLLGFNVRK DWINRSKVHG QVVSRKFTCS QEGWKDKRDA  120
NVKKHRKETR SGCLAHMIVN RQPDGKYQRY GERRSRVCLL GYFQRQHFEN PTFFYAIQLD  180
VEDKVSNLFW ADDNMVVDYD HFGDVICLDT TCRTNKDLRP FVQFLGVNHH KQPKAILTEQ  240
EAVIIEAVNT VLSDTNHCTC VWQLYENTLK YLSHVVKDAE SFANDLRRSI YDPKDEEFTR  300
AWEAMLEKYN LQQNEWLRWI YREREMGCFH LGEILSHKFR SYLNHDLDVL QFFKHFERVV  360
DEQRYKEIEA SEENEQHASD IYTPRAFEVF QGAYEKSLNV LYKANTFGHT RQYNVTFNSS  420
DDTVVCSCMK FERVGCLCSH ALKVLDHTNI KVVPSQYILD RWTGDARLGN LREIKQLTMQ  480
GNPNMVVASC YKDLCHRLLK LSVRASESME AYQFSARQLD EVMVGVEKIL ALKAEEGQVI  540
TSSNIDANAS ENEPAEIFLN GHAIEDQDES NRANGGKDRR ATSDRGYLTT MTFNGADSDR  600
ILNVEVSPPN TVVCISSPSS AYVSSHSASP NPILQGMYSF EANQVVHCMY EQTNHVLDHQ  660
SNSNTLQPPN IFSNQQDCPG QSQLLQEPII QSTYHASMPC NNQMRQGIDL DIQNPHSSSF  720
LLYDHRYRSS ESA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.217970.0flower| hypocotyl| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618844.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLK7N3N20.0K7N3N2_SOYBN; Uncharacterized protein
STRINGGLYMA20G29541.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22170.23e-56far-red elongated hypocotyls 3